A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10465
Swiss-prot Accession number	P51921 (Sequence in FASTA format)
Description	Progonadoliberin-3 precursor (Progonadoliberin III) [Contains:Gonadoliberin-3 (Gonadoliberin III) (Luteinizing hormone-releasinghormone III) (LH-RH III) (Gonadotropin-releasing hormone III) (GnRHIII) (Luliberin III); GnRH-associated peptide 3 (GnRH-associatedpeptide III)].
Source organism	Pagrus major (Red sea bream) (Chrysophrys major)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Sparidae; Pagrus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	90 Amino acids
Molecular weight	10071
References	1  PubMed abstract 7851723
Domain Name	N/A
Hormone Name	Gonadoliberin-3
Mature Hormone Sequence	QHWSYGWLPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (24-33)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10505
Swiss-prot Accession number	P70074 (Sequence in FASTA format)
Description	Progonadoliberin-1 precursor (Progonadoliberin I) [Contains:Gonadoliberin-1 (Gonadoliberin I) (Luteinizing hormone-releasinghormone I) (LH-RH I) (Gonadotropin-releasing hormone I) (GnRH-I)(Luliberin I); GnRH-associated peptide 1 (GnRH-associated peptide I)].
Source organism	Pagrus major (Red sea bream) (Chrysophrys major)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Sparidae; Pagrus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	95 Amino acids
Molecular weight	10566
References	1   Okuzawa K., Granneman J., Bogerd J., Goos H., Zohar Y., Kagawa H.; Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases.
Domain Name	N/A
Hormone Name	Gonadoliberin-1
Mature Hormone Sequence	QHWSYGLSPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (24-33)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10755
Swiss-prot Accession number	P08591 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Pagrus major (Red sea bream) (Chrysophrys major)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Sparidae; Pagrus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation
Protein Length	203 Amino acids
Molecular weight	22900
References	1  PubMed abstract 3368321
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	QPITDGQRLFSIAVSRVQHLHLLAQRLFSDFESSLQTEEQLKLNKIFPDFCNSDYIISPIDKHETQRSSVLKLLSISYRLVESWEFPSRSLSGGSAPRNQISPKLSELKMGIHLLIRANEDGAEIFPDSSALQLAPYGNYYQSLGADESLRRTYELLACFKKDMHKVETYLTVAKCRLSPEANCTL
Position of mature hormone in Pre-Hormone protein	186 Residues from position (18-203)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated